One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA (By similarity). MPRKGAPAKREVLADPMYNSKLVTRLINHLMLDGKRGTASTILYDAFDQIKEQTGNDPLEVFEEAMKNVMPVLEVKARRVGGSNYQVPIEVRPDRKTTLGLRWIVQYARSRGEHTMSDRLAREIMDAANNTGASVKKREDTHRMAEANRAFAHYRW lp_1026 RS7_LACPL 156 30S ribosomal protein S7 rpsG